Liraglutide
Also known as: Saxenda, Victoza
Molecular Formula
Molecular Weight
3,751.262 Da
Half-Life
~13 hours
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG (C-16 palmitic acid via glutamic acid spacer at Lys26)
Clinical Applications & Evidence
Mechanism of Action
Liraglutide functions as an agonist at the GLP-1 receptor. It stimulates glucose-dependent insulin secretion from pancreatic beta cells, suppresses inappropriate glucagon secretion from alpha cells, slows gastric emptying, and centrally regulates appetite to reduce caloric intake. Furthermore, it modulates intracellular signaling pathways, including AMPK activation and mTORC1 inhibition, to induce autophagy and protect against cellular apoptosis.
Investigated Uses
- Type 2 Diabetes management (Victoza)
- Chronic weight management (Saxenda)
- Non-alcoholic steatohepatitis (NASH)
- Cardiovascular risk reduction (LEADER trial)
- Pediatric obesity (age 12+, FDA approved)
- Parkinson's disease (neuroprotection)
- Alzheimer's disease (autophagy/mTOR modulation)
Regulatory & Safety Status
FDA Status
FDA ApprovedWADA / Athletic Status
Not ProhibitedKnown Side Effects
Contraindications
- Personal or family history of medullary thyroid carcinoma
- Multiple endocrine neoplasia syndrome type 2
- History of pancreatitis
Drug Interactions
- Insulin and sulfonylureas (increased hypoglycemia risk)
- Oral medications (delayed absorption)