LL-37
Also known as: Cathelicidin, hCAP-18 Active Peptide
Molecular Formula
Molecular Weight
4,493.33 Da
Half-Life
~1 hour (cellular); 43.5–74.6 hours (stabilized plasma conditions)
Sequence
[LL-37, 37 aa]
Clinical Applications & Evidence
Mechanism of Action
Eradicates pathogens via a non-pore-forming 'carpet mechanism' that disrupts bacterial lipid bilayers through electrostatic interactions. Modulates immunity by neutralizing lipopolysaccharides (LPS), acting as a chemoattractant via FPRL-1, activating EGFR and MAP kinase pathways for angiogenesis, and complexing with nucleic acids to stimulate Toll-like receptors.
Investigated Uses
- Chronic and recurrent infections
- Biofilm-associated infections
- Upper respiratory infection prevention
- Wound healing support
- Lyme disease adjunct (investigational)
Regulatory & Safety Status
FDA Status
Compounding EligibleWADA / Athletic Status
Prohibited in CompetitionKnown Side Effects
Contraindications
- Autoimmune conditions (may exacerbate)
- Rosacea (paradoxical LL-37 overexpression)
Drug Interactions
- May interact with immunosuppressant therapies
- Synergistic with certain antibiotics