LL-37
Also known as: Cathelicidin C-Terminal Active Fragment, hCAP-18 Active Peptide
Molecular Formula
Molecular Weight
4,493.33 Da
Half-Life
Unknown in human circulation (lacks in-vivo human PK studies; stability varies by matrix and formulation in vitro)
Sequence
[LL-37, 37 aa]
Clinical Applications & Evidence
Mechanism of Action
In experimental models, LL-37 disrupts bacterial cell membranes via electrostatic interactions (carpet mechanism, oligomerization, and pore formation depending on lipid composition). It neutralizes bacterial lipopolysaccharides (LPS), acts as a chemoattractant via FPR2/ALX (formerly FPRL1) receptors, activates EGFR and MAPK pathways to promote epithelial cell migration and angiogenesis, and complexes with extracellular nucleic acids to modulate Toll-like receptor signaling.
Investigated Uses
- Topical chronic wound healing (Investigational — Phase 1/2 venous leg ulcer & diabetic foot ulcer trials; mixed efficacy)
- Antimicrobial & antibiofilm activity (Preclinical in-vitro & animal models)
- Epithelial repair & angiogenesis (Preclinical cell & animal models)
Regulatory & Safety Status
FDA Status
Research OnlyWADA / Athletic Status
Not Explicitly ProhibitedKnown Side Effects
Contraindications
- WADA-tested athletes (Unapproved substance under S0 Non-Approved Substances)
- Mechanistic uncertainty in psoriasis, rosacea, and systemic lupus (conditions associated with endogenous LL-37 overexpression)
- Pregnancy and systemic administration (Unstudied; unknown safety profile)
Drug Interactions
- Antibiotics (In-vitro co-incubation studies report synergistic bacterial inhibition with select agents)
- Immunosuppressive therapies (Theoretical immunomodulatory overlap; clinical interactions unstudied)